| Detail-Interactions: | |
| RAID ID: | RRI00000114 |
|---|---|
| RNA/Protein Symbol 1: | CDKN2B-AS1(ANRIL) |
| RNA/Protein Category 1: | lncRNA |
| RNA/Protein Symbol 2: | CDKN2B mRNA(p15/CDKN2B) |
| RNA/Protein Category 2: | mRNA |
| Validated Method: | |
| Tissue: | |
| PMID: | 17440112 |
| Detail description: | We identified a new large antisense noncoding RNA (named ANRIL) within the 403-kb germ-line deletion, with a first exon located in the promoter of the p14/ARF gene and overlapping the two exons of p15/CDKN2B. |
| The Predicated Binding Sites between CDKN2B-AS1 and CDKN2B | |||||
| By miRanda | Structure | Match Score | Energy Score | CDKN2B-AS1 Location | CDKN2B Location |
| The Predicated Binding Sites between CDKN2B-AS1 and CDKN2B | ||||
| By RIsearch | Structure | CDKN2B-AS1 Location | CDKN2B Location | Score | Query: 3' GCUGGGAUUUGAACUUAAGCAGUCUAACCUU--------AGAGU 5'
|| ||| ||:| |:|: |||: |||||
Target: 5' CG--CCUC---AGGAGUG--ACGGGGCGGAGCGAGACCGUCUCA 3'
|
3734-3769 | 9-45 | -13.86 |
| The Predicated Binding Sites of CDKN2B | |
| RBPBD | |
| RsiteDB | |
| BindN |
>sp|P42772|CDN2B_HUMAN Cyclin-dependent kinase 4 inhibitor B OS=Homo sapiens GN=CDKN2B PE=1 SV=1 Sequence: MREENKGMPSGGGSDEGLASAAARGLVEKVRQLLEAGADPNGVNRFGRRAIQVMMMGSAR Prediction: -+--++--++++-+-----+---+------+---------++-++--++----------+ Confidence: 665346226864263235564369346439458857564354468229677287775286 Sequence: VAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLA Prediction: ------------------+--+--+---+-----------+---+---+----+------ Confidence: 885999957645346445552758526666649879999564449546736265978566 Sequence: EERGHRDVAGYLRTATGD Prediction: --+--+------++-+-- Confidence: 345326354526763542 *** Prediction: binding residues are labeled with '+' and in red; non-binding residues labeled with '-' and in green. *** Confidence: from level 0 (lowest) to level 9 (highest). |
| BindN+ |
>sp|P42772|CDN2B_HUMAN Cyclin-dependent kinase 4 inhibitor B OS=Homo sapiens GN=CDKN2B PE=1 SV=1 Sequence: MREENKGMPSGGGSDEGLASAAARGLVEKVRQLLEAGADPNGVNRFGRRAIQVMMMGSAR Prediction: -+---+-----+-+-+------------------------+-------+----------- Confidence: 544543341234241626255663668899599844661236323452566284673476 Sequence: VAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLA Prediction: --------------------------------------------+--------------- Confidence: 995998427623274566486687297936858999688823563337224234377587 Sequence: EERGHRDVAGYLRTATGD Prediction: ------------------ Confidence: 853625899488522231 *** Prediction: binding residues are labeled with '+' and in red; non-binding residues labeled with '-' and in green. *** Confidence: from level 0 (lowest) to level 9 (highest). |
| RNAbindR |
>P42772|CDKN2B Sequence: MREENKGMPSGGGSDEGLASAAARGLVEKVRQLLEAGADPNGVNRFGRRAIQVMMMGSAR Prediction: -++-+++-+-+++-+++++-++++-+------+-+++++-++++++++++++-+++++-+ Confidence: 255377546358545577646567370300415279775467789999997947676825 Sequence: VAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLA Prediction: ----+-++++--+--++++++-+++---++-+--------+++++--+++++++++++-+ Confidence: 212152598743634578675466644355250211224268665245667878565615 Sequence: EERGHRDVAGYLRTATGD Prediction: -++-+--------+++++- Confidence: 1653723112121786880 *** Prediction: binding residues are labeled with '+' and in red; non-binding residues labeled with '-' and in green. *** Confidence: from level 0 (lowest) to level 9 (highest). |
| Pprint |
Sequence: MREENKGMPSGGGSDEGLASAAARGLVEKVRQLLEAGADPNGVNRFGRRAIQVMMMGSAR Prediction: +++++++++++++++--++-----------------+++++++++++++++++------- Confidence: 553376579988877227500010000000301233435955874654543740200000 Sequence: VAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLA Prediction: ------++++-++-----------+----------------+---++----+++-+++-- Confidence: 000000686428631212002220600220030000000014302930121656264510 Sequence: EERGHRDVAGYLRTATGD Prediction: ------------------ Confidence: 010000000000023212 ***Prediction: binding residues are labeled with '+' and in red; non-binding residues labeled with '-' and in green. ***Confidence: from level 0 (lowest) to level 9 (highest). |
The 'First Node' or 'Second Node' option represents the sub-network of interacting RNA/Protein with the first or second interaction node,
the 'Both the Nodes' option represents the sub-network of interacting RNA/Protein with both of interaction nodes.
The 'First Neighbour' represents the sub-network of direct interacting with the center node,
the 'Second Neighbour' represents the sub-network of direct or second step interacting with the center node.
Interaction sub-network based on the two nodes of this interaction may help the researchers represents all interacting partners immediately.
The Detail page: representing the detail information for RNA-RNA/RNA-Protein interaction;
The Binding page: representing the predicted binding sites and/or constants.
The Network page: representing the interaction sub-network of interacting RNA/Protein.