Basic information:

Translated ncRNA: lncRNA

Related IDs	cncRNA ID	CNC_N_000300
	Name	LINC01560
	Gene ID	ENSG00000196741
Location	Coordinate(Strand)	X:47483571-47484823(+)
Locus Sequence
Organism	Homo sapiens

Peptide information:

  

Peptide	MGALFRLLLQERGKAAEFYSRGRKQRRPSASCTFGGIWSSGVDMLPNGAVGSLTQLGPSRPVLGIDYSKKEFRGTAENVTGLNTILHFRKRTRS
Peptide length	94

Evidence support:

  

In vivo/vitro assay	In vitro assay
Low-throughput method	In vitro translation assay
High-throughput method	/
Tissue/Cell	/
Description of experimental evidence	The peptide was detected by in vitro translation assay.

Orthologues:

  

Chimpanzee	/
Mouse	/
Drosophila	/
Zebrafish	/

References:

  

PMID	31155234
Description	We identify hundreds of previously undetected microproteins, expressed from lncRNAs and circRNAs, for which we validate the protein products in vivo. The data were collected from supplementary tables.

Related Subcelluar Localization:

  

Subcelluar Localization	RLID	Link to RNALocate
exosome	RLID00063504	Link to RNALocate

Related Interactions:

  

  

   Notes: You can browse the related interactions in RNAinter by click the above link (since the interaction entries are too much to show here).