Basic information:

Translated ncRNA: lncRNA

Related IDs	cncRNA ID	CNC_N_000268
	Name	MUC20-OT1
	Gene ID	ENSG00000242086
Location	Coordinate(Strand)	3:195658062-195739964(+)
Locus Sequence
Organism	Homo sapiens

Peptide information:

  

Peptide	GSDWLGDQDAIHYVTEQAPTAMVEVENYGMPFSR
Peptide length	34

Evidence support:

  

In vivo/vitro assay	In vitro assay
Low-throughput method	/
High-throughput method	Liquid chromatography-tandem mass spectrometry (LC-MS/MS)
Tissue/Cell	Heart
Description of experimental evidence	The peptide was detected by LC-MS/MS in heart.

Orthologues:

  

Chimpanzee	/
Mouse	/
Drosophila	/
Zebrafish	/

References:

  

PMID	31155234
Description	We identify hundreds of previously undetected microproteins, expressed from lncRNAs and circRNAs, for which we validate the protein products in vivo. The data were collected from supplementary tables.

Related Diseases:

  

Disease	MNDR ID	Link to MNDR
Astrocytoma	MNDR-E-LNC-18578	Link to MNDR
Non-small cell lung carcinoma	MNDR-E-LNC-18579	Link to MNDR

Related Interactions:

  

  

   Notes: You can browse the related interactions in RNAinter by click the above link (since the interaction entries are too much to show here).