Basic information:

Translated ncRNA: lncRNA

Related IDs	cncRNA ID	CNC_N_000241
	Name	LINC00467
	Gene ID	ENSG00000153363
Location	Coordinate(Strand)	1:211382736-211435570(+)
Locus Sequence
Organism	Homo sapiens

Peptide information:

  

Peptide	SVTSFSSDDPMFPSSSSSSSGSQTDSSIEDAAK
Peptide length	33

Evidence support:

  

In vivo/vitro assay	In vitro assay
Low-throughput method	/
High-throughput method	Liquid chromatography-tandem mass spectrometry (LC-MS/MS)
Tissue/Cell	Heart
Description of experimental evidence	The peptide was detected by LC-MS/MS in heart.

Orthologues:

  

Chimpanzee	/
Mouse	/
Drosophila	/
Zebrafish	/

References:

  

PMID	31155234
Description	We identify hundreds of previously undetected microproteins, expressed from lncRNAs and circRNAs, for which we validate the protein products in vivo. The data were collected from supplementary tables.

Related Subcelluar Localization:

  

Subcelluar Localization	RLID	Link to RNALocate
chromatin	RLID00109881	Link to RNALocate
nucleus	RLID00109882	Link to RNALocate
exosome	RLID00109883	Link to RNALocate
Ribosome	RLID00023922	Link to RNALocate

Related Diseases:

  

Disease	MNDR ID	Link to MNDR
Muscle-invasive bladder cancer	MNDR-E-LNC-11411	Link to MNDR
Primary breast cancer	MNDR-E-LNC-11412	Link to MNDR
Glioblastoma multiforme	MNDR-E-LNC-11413	Link to MNDR
Astrocytoma	MNDR-E-LNC-11414	Link to MNDR
Glioma	MNDR-E-LNC-11415	Link to MNDR
Lung adenocarcinoma	MNDR-E-LNC-11416	Link to MNDR
Esophageal cancer	MNDR-E-LNC-11417	Link to MNDR
Head and neck squamous cell carcinoma	MNDR-E-LNC-11418	Link to MNDR
Hepatocellular carcinoma	MNDR-E-LNC-11419	Link to MNDR
Neuroblastoma	MNDR-E-LNC-11420	Link to MNDR
Colorectal cancer	MNDR-E-LNC-11421	Link to MNDR
Spinal cord injury	MNDR-E-LNC-35126	Link to MNDR

Related Interactions:

  

  

   Notes: You can browse the related interactions in RNAinter by click the above link (since the interaction entries are too much to show here).