Basic information:

Translated ncRNA: lncRNA

Related IDs	cncRNA ID	CNC_N_000233
	Name	MTLN
	Gene ID	ENSG00000175701
Location	Coordinate(Strand)	2:110211529-110245420(-)
Notes	It has been re-annotated as protein coding gene now
Locus Sequence
Organism	Homo sapiens

Peptide information:

  

Peptide	MADVSERTLQLSVLVAFASGVLLGWQANRLRRRYLDWRKRRLQDKLAATQKKLDLA
Peptide length	56

Evidence support:

  

In vivo/vitro assay	In vitro assay and in vivo assay (Mouse)
Low-throughput method	Immunofluorescence staining
High-throughput method	/
Tissue/Cell	C2C12 cell
Description of experimental evidence	The peptide was detected by immunofluorescence staining in C2C12 cell, which can enhance mitochondrial respiratory activity and promote myogenic differentiation.

Orthologues:

  

Chimpanzee	ENSPTRG00000050960
Mouse	ENSMUSG00000051319
Drosophila	/
Zebrafish	/

References:

  

PMID	31296841
Description	We identified a novel muscle-enriched micropeptide that was localized to mitochondria (named MPM, micropeptide in mitochondria) and upregulated during in vitro differentiation of C2C12 myoblasts and in vivo early postnatal skeletal muscle development, and muscle regeneration after cardiotoxin (CTX) damage.