Go Back
Detail Information
Basic information:
Translated ncRNA: circRNA
| Related IDs | cncRNA ID | CNC_N_000065 | |
|---|---|---|---|
| Name | LINC-PINT | ||
| Gene ID | ENSG00000231721 | ||
| Location | Coordinate(Strand) | 7:130938963-131110176(-) | |
| Locus Sequence | |||
| Organism | Homo sapiens | ||
Peptide information:
| Peptide | MLWLPDRGSCSARSGMLRGAPGGWRYGRRCGRRRQSCCCCCCCSHVGAPLSFHREASLVSHDGHDIMKQHCGEESIRGAHGYKNK | |
|---|---|---|
| Peptide length | 85 | |
Evidence support:
| In vivo/vitro assay | In vitro assay and in vivo assay (Mouse) | |
|---|---|---|
| Low-throughput method | Western blotting;Immunostaining;Liquid chromatography-tandem mass spectrometry (LC-MS/MS) | |
| High-throughput method | / | |
| Tissue/Cell | 293T cell | |
| Description of experimental evidence | The peptide was detected by western blotting, immunostaining and LC-MS/MS in 293T cell, which can suppress oncogenic transcriptional elongation in glioblastoma. | |
Orthologues:
| Chimpanzee | / |
|---|---|
| Mouse | / |
| Drosophila | / |
| Zebrafish | / |
References:
| PMID | 30367041 |
|---|---|
| Description | We identify an 87-amino-acid peptide encoded by the circular form of the long intergenic non-protein-coding RNA p53-induced transcript (LINC-PINT) that suppresses glioblastoma cell proliferation in vitro and in vivo. This peptide directly interacts with polymerase associated factor complex (PAF1c) and inhibits the transcriptional elongation of multiple oncogenes. |
Related Subcelluar Localization:
| Subcelluar Localization | RLID | Link to RNALocate |
|---|---|---|
| Nucleus | RLID00011847 | Link to RNALocate |
| Nucleus | RLID00011848 | Link to RNALocate |
| Nucleus | RLID00011849 | Link to RNALocate |
| chromatin | RLID00078020 | Link to RNALocate |
| nucleolus | RLID00078021 | Link to RNALocate |
| nucleoplasm | RLID00078022 | Link to RNALocate |
| nucleus | RLID00078023 | Link to RNALocate |
| nucleus | RLID00078024 | Link to RNALocate |
| exosome | RLID00078025 | Link to RNALocate |
| Nucleus | RLID00037873 | Link to RNALocate |
Related Diseases:
| Disease | MNDR ID | Link to MNDR |
|---|---|---|
| Prostate cancer | MNDR-E-LNC-13340 | Link to MNDR |
| Gastric cancer | MNDR-E-LNC-13341 | Link to MNDR |
| Lung cancer | MNDR-E-LNC-13342 | Link to MNDR |
| Thyroid cancer | MNDR-E-LNC-13343 | Link to MNDR |
| Pancreatic cancer | MNDR-E-LNC-13344 | Link to MNDR |
| Melanoma | MNDR-E-LNC-13345 | Link to MNDR |
| Laryngeal cancer | MNDR-E-LNC-13346 | Link to MNDR |
| Osteosarcoma | MNDR-E-LNC-13347 | Link to MNDR |
| Lung adenocarcinoma | MNDR-E-LNC-13348 | Link to MNDR |
| Renal cell carcinoma | MNDR-E-LNC-13349 | Link to MNDR |
| Esophageal cancer | MNDR-E-LNC-13350 | Link to MNDR |
| Colorectal cancer | MNDR-E-LNC-13351 | Link to MNDR |
| Acute lymphoblastic leukemia | MNDR-E-LNC-13352 | Link to MNDR |
Related Interactions:
Notes: You can browse the related interactions in RNAinter by click the above link (since the interaction entries are too much to show here).