Basic information:

Translated ncRNA: lncRNA

Related IDs	cncRNA ID	CNC_N_000221
	Name	kdpF
	Gene ID	3205056
Locus Sequence
Organism	Mycobacterium tuberculosis

Peptide information:

  

Peptide	MTTVDNIVGLVIAVALMAFLFAALLFPEKF
Peptide length	30

Evidence support:

  

In vivo/vitro assay	In vitro assay and in vivo assay (Human and murine primary macrophage)
Low-throughput method	Bacterial two-hybrid analysis
High-throughput method	/
Tissue/Cell	Mycobacterium bovis BCG
Description of experimental evidence	The peptide was detected by Bacterial two-hybrid analysis in BTH101 bacteria, which can reduce intramacrophage growth and altered cording morphology.

Orthologues:

  

Human	/
Chimpanzee	/
Mouse	/
Drosophila	/
Zebrafish	/

References:

  

PMID	23577107
Description	The 30 amino-acid-long KdpF peptide, which is co-transcribed with kdpABC genes and regulated by the KdpDE two-component system, is supposed to stabilize the KdpABC potassium transporter complex but may also exhibit unsuspected regulatory function(s) towards the KdpD sensor kinase.