Go Back
Detail Information
Basic information:
Translated ncRNA: circRNA
| Related IDs | cncRNA ID | CNC_N_000054 | |
|---|---|---|---|
| Name | circ-FBXW7 | ||
| Gene ID | ENSG00000109670 | ||
| Location | Coordinate(Strand) | 4:152320544-152536092(-) | |
| Locus Sequence | |||
| Organism | Homo sapiens | ||
Peptide information:
| Peptide | MNQELLSVGSKRRRTGGSLRGNPSSSQVDEEQMNRVVEEEQQQQLRQQEEEHTARNGEVVGVEPRPGGQNDSQQGQLEENNNRFISVDEDSSGNQEEQEEDEEHAGEQDEEDEEEEEMDQESDDFDQSDDSSREDEHTHTNSVTNSSSIVDLPVHQLSSPFYTKTTKDYFLRIDCQKWSYWVRGM | |
|---|---|---|
| Peptide length | 185 | |
Evidence support:
| In vivo/vitro assay | In vitro assay and in vivo assay (Mouse) | |
|---|---|---|
| Low-throughput method | Western blotting;Liquid chromatography-tandem mass spectrometry (LC-MS/MS) | |
| High-throughput method | / | |
| Tissue/Cell | Glioblastoma;Brain;293T cell;HEK293T cell;U251 cell;U373 cell;Hs683 cell;SW1783 cell | |
| Description of experimental evidence | The peptide was detected by western blotting and LC/MS in 293T cell, which can repress glioma tumorigenesis. | |
Orthologues:
| Chimpanzee | ENSPTRG00000016514 |
|---|---|
| Mouse | ENSMUSG00000028086 |
| Drosophila | FBgn0041171 |
| Zebrafish | ENSDARG00000060994 |
References:
| PMID | 28903484 |
|---|---|
| Description | Circ-FBXW7 encodes a novel 21-kDa protein, which we termed FBXW7-185aa. Upregulation of FBXW7-185aa in cancer cells inhibited proliferation and cell cycle acceleration, while knockdown of FBXW7-185aa promoted malignant phenotypes invitro and invivo. |