Go Back

Detail Information


Basic information:


Translated ncRNA: circRNA

Related IDs cncRNA ID CNC_N_000015
Name circBeta-catenin
Gene ID ENSG00000168036
Location Coordinate(Strand) 3:41194741-41260096(+)
Locus Sequence
Organism Homo sapiens

Peptide information:

  
Peptide MATQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDTSQVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHPTNVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSKKEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGYLKYTIQLF
Peptide length 370

Evidence support:

  
In vivo/vitro assay In vitro assay and in vivo assay (Mouse)
Low-throughput method Western blotting;Liquid chromatography-tandem mass spectrometry (LC-MS/MS)
High-throughput method /
Tissue/Cell SW620 cell;Huh7 cell;HepG2 cell;PLC/PRF/5 cell;HEK293 cell
Description of experimental evidence The peptide was detected by western blotting and LC-MS/MS in PLC/PRF/5 cell, which can promote liver cancer cell growth through activation of the Wnt pathway.

Orthologues:

  
Chimpanzee ENSPTRG00000023062  
Mouse ENSMUSG00000006932  
Drosophila /
Zebrafish ENSDARG00000014571  

References:

  
PMID 31027518
Description CircBeta-catenin produces a novel 370-amino acid Beta-catenin isoform that uses the start codon as the linear Beta-catenin mRNA transcript and translation is terminated at a new stop codon created by circularization.