Basic information:

Translated ncRNA: lncRNA

Related IDs	cncRNA ID	CNC_N_000212
	Name	HOXB-AS3
	Gene ID	ENSG00000233101
Location	Coordinate(Strand)	17:48549630-48606414(+)
Locus Sequence
Organism	Homo sapiens

Peptide information:

  

Peptide	MPVLPGTQRYPHQRRRFQAAGGGAESGKRGSEEAPGVAWSGSESGRDAATPAW
Peptide length	53

Evidence support:

  

In vivo/vitro assay	In vitro assay and in vivo assay (Mouse)
Low-throughput method	GFP Immunofluorescence;Liquid chromatography-tandem mass spectrometry (LC-MS/MS)
High-throughput method	/
Tissue/Cell	Hela cell;SW480 cell;HTC-116 cell;SW620 cell
Description of experimental evidence	The peptide was detected by Immunofluorescence staining in Hela cell and SW480 cell, which can suppress colon cancer growth.

Orthologues:

  

Chimpanzee	/
Mouse	/
Drosophila	/
Zebrafish	/

References:

  

PMID	28985503
Description	A Peptide encoded by a putative lncRNA HOXB-AS3 suppresses colon cancer growth.

Related Subcelluar Localization:

  

Subcelluar Localization	RLID	Link to RNALocate
chromatin	RLID00079610	Link to RNALocate
membrane	RLID00079611	Link to RNALocate
nucleolus	RLID00079612	Link to RNALocate
nucleoplasm	RLID00079613	Link to RNALocate
nucleus	RLID00079614	Link to RNALocate
exosome	RLID00079615	Link to RNALocate
Nucleus	RLID00039428	Link to RNALocate
Cytoplasm	RLID00039429	Link to RNALocate

Related Diseases:

  

Disease	MNDR ID	Link to MNDR
Lung cancer	MNDR-E-LNC-10267	Link to MNDR
Thyroid cancer	MNDR-E-LNC-10268	Link to MNDR
Colon cancer	MNDR-E-LNC-10269	Link to MNDR
Esophageal cancer	MNDR-E-LNC-10270	Link to MNDR
Hepatocellular carcinoma	MNDR-E-LNC-10271	Link to MNDR
Acute myeloid leukemia	MNDR-E-LNC-10272	Link to MNDR
Colorectal cancer	MNDR-E-LNC-10273	Link to MNDR

Related Interactions:

  

  

   Notes: You can browse the related interactions in RNAinter by click the above link (since the interaction entries are too much to show here).