Basic information:

Translated ncRNA: lncRNA

Related IDs	cncRNA ID	CNC_N_000201
	Name	Gm11549
	Gene ID	ENSMUSG00000085007
Location	Coordinate(Strand)	3:36515057-36532384(-)
Notes	It has been re-annotated as protein coding gene now
Locus Sequence
Organism	Mus musculus

Peptide information:

  

Peptide	MEWKLNLLLYLALFFFLLFLLFLLLFVVIK
Peptide length	30

Evidence support:

  

In vivo/vitro assay	In vitro assay
Low-throughput method	/
High-throughput method	Liquid chromatography-tandem mass spectrometry (LC-MS/MS)
Tissue/Cell	Muscle
Description of experimental evidence	The peptide was detected by LC-MS/MS in muscle.

Orthologues:

  

Human	/
Chimpanzee	/
Drosophila	/
Zebrafish	/

References:

  

PMID	26364619
Description	Published ribosome profiling data indicate translation of more than 100 novel sORFs, and mass spectrometry data provide evidence for more than 70 novel candidates. The data were collected from supplementary tables.

Related Interactions:

  

  

   Notes: You can browse the related interactions in RNAinter by click the above link (since the interaction entries are too much to show here).