Go Back
Detail Information
Basic information:
Translated ncRNA: lncRNA
| Related IDs | cncRNA ID | CNC_N_001813 | |
|---|---|---|---|
| Name | Aw112010 | ||
| Gene ID | ENSMUSG00000075010 | ||
| Location | Coordinate(Strand) | 19:11047612-11055808(-) | |
| Locus Sequence | |||
| Organism | Mus musculus | ||
Peptide information:
| Peptide | LSCKMSPIPLIFIFGGVLIICLMQQYLAYKSSKNVVKVFCHQANDVHIYQTQVVMTNTLETSSGKSHPLGRSGEIQSLKKQN | |
|---|---|---|
| Peptide length | 84 | |
Evidence support:
| In vivo/vitro assay | In vitro assay and in vivo assay (Mouse) | |
|---|---|---|
| Low-throughput method | Immunoprecipitation;Liquid chromatography-tandem mass spectrometry (LC-MS/MS);Western blotting | |
| High-throughput method | / | |
| Tissue/Cell | BMDM cell | |
| Description of experimental evidence | The peptide was detected by western blotting, immunoprecipitation and LC-MS/MS in BMDM cell, which can control mucosal immunity. | |
Orthologues:
| Human | / |
|---|---|
| Chimpanzee | / |
| Drosophila | / |
| Zebrafish | / |
References:
| PMID | 30542152 |
|---|---|
| Description | We show that the translation of a new ORF 'hidden' within the long non-coding RNA Aw112010 is essential for the orchestration of mucosal immunity during both bacterial infection and colitis. |