Basic information:

Translated ncRNA: lncRNA

Related IDs	cncRNA ID	CNC_N_001811
	Name	APELA
	Gene ID	ENSG00000248329
Location	Coordinate(Strand)	4:164877178-164898965(+)
Notes	It has been re-annotated as protein coding gene now
Locus Sequence
Organism	Homo sapiens

Peptide information:

  

Peptide	QRPVNLTMRRKLRKHNCLQRRCMPLHSRVPFP
Peptide length	32

Evidence support:

  

In vivo/vitro assay	In vitro assay and in vivo assay (Zebrafish embryo)
Low-throughput method	Western blotting;Immunofluorescence
High-throughput method	/
Tissue/Cell	Xenopus laevis embryo;Human embryonic stem cells
Description of experimental evidence	The peptide was detected by western blotting in Xenopus laevis embryo and immunofluorescence in Human embryonic stem cells, is the earliest ligand recognized by Aplnr, which mediates its effect on endoderm differentiation and subsequent cardiogenesis.

Orthologues:

  

Chimpanzee	ENSPTRG00000044082
Mouse	/
Drosophila	/
Zebrafish	/

References:

  

PMID	24316148
Description	We report here the discovery and characterization of a gene, ELABELA (ELA), encoding a conserved hormone of 32 amino acids. Present in human embryonic stem cells, ELA is expressed at the onset of zebrafish zygotic transcription and is ubiquitous in the naive ectodermal cells of the embryo.