Go Back

Detail Information


Basic information:


Translated ncRNA: lncRNA

Related IDs cncRNA ID CNC_N_001810
Name tal-AA
Gene ID 7354377
Location Coordinate(Strand) 3R:13813109-13814648(+)
Notes It has been re-annotated as protein coding gene now
Locus Sequence
Organism Drosophila melanogaster

Peptide information:

  
Peptide MLDPTGTYRRPRDTQDSRQKRRQDCLDPTGQY
Peptide length 32

Evidence support:

  
In vivo/vitro assay In vitro assay and in vivo assay (Embryo)
Low-throughput method In situ hybridisation;TNT Quick Coupled Transcription;Translation reticulocyte system;GFP fluorescence;Immunostaining;Immunohistochemistry
High-throughput method /
Tissue/Cell S2R+ cell
Description of experimental evidence The peptide was detected by TNT Quick Coupled Transcription, translation reticulocyte system and GFP fluorescence in S2R+ cell, which can control gene expression and tissue folding in Drosophila, thus acting as a link between patterning and morphogenesis.

Orthologues:

  
Human /
Chimpanzee /
Mouse /
Zebrafish /

References:

  
PMID 17439302
Description Here we present the characterisation of tarsal-less (tal), a new type of noncanonical gene that had been previously classified as a putative noncoding RNA. tal function is mediated by several 33-nucleotide-long open reading frames (ORFs), which are translated into 11-amino-acid-long peptides.