Basic information:

Translated ncRNA: lncRNA

Related IDs	cncRNA ID	CNC_N_001804
	Name	pgc
	Gene ID	5740599
Location	Coordinate(Strand)	2R:22330200-22332813(+)
Notes	It has been re-annotated as protein coding gene now
Locus Sequence
Organism	Drosophila melanogaster

Peptide information:

  

Peptide	MCDYQMEYSFIFEDSSCEGDASMASYDNGFESMWHQVREELQREREMNELCQVFQQNLSLSPPVIADRWRF
Peptide length	71

Evidence support:

  

In vivo/vitro assay	In vitro assay and in vivo assay (Embryo)
Low-throughput method	Western blotting
High-throughput method	/
Tissue/Cell	S2 cell
Description of experimental evidence	The peptide was detected by western blotting in S2 cell, which can inhibit P-TEFb recruitment to chromatin in primordial germ cells.

Orthologues:

  

Human	/
Chimpanzee	/
Mouse	/
Zebrafish	/

References:

  

PMID	18200011
Description	Here we show that, in Drosophila embryos, a small protein encoded by polar granule component (pgc) is essential for repressing CTD Ser 2 phosphorylation in newly formed pole cells, the germline progenitors. These results indicate that Pgc is a cell-type-specific P-TEFb inhibitor that has a fundamental role in Drosophila germ cell specification.