Basic information:

Translated ncRNA: lncRNA

Related IDs	cncRNA ID	CNC_N_001800
	Name	ROT4
	Gene ID	2745585
Location	Coordinate(Strand)	2:15534739-15535304(-)
Notes	It has been re-annotated as protein coding gene now
Locus Sequence
Organism	Arabidopsis thaliana

Peptide information:

  

Peptide	MAPEENGTCEPCKTFGQKCSHVVKKQRAKFYILRRCIAMLVCWHDQNHDRKDS
Peptide length	53

Evidence support:

  

In vivo/vitro assay	In vitro assay and in vivo assay (Arabidopsis thaliana)
Low-throughput method	GFP fluorescence
High-throughput method	/
Tissue/Cell	Leaf
Description of experimental evidence	The peptide was detected by GFP fluorescence in leaf, which can decrease cell proliferation and alter leaf shape in Arabidopsis thaliana.

Orthologues:

  

Human	/
Chimpanzee	/
Mouse	/
Drosophila	/
Zebrafish	/

References:

  

PMID	15125775
Description	Overexpression of a ROT4-green fluorescence protein (GFP) fusion protein in transgenic plants recapitulated the rot4 phenotype, suggesting that ROT4 acts to restrict cell proliferation.