Basic information:

Translated ncRNA: lncRNA

Related IDs	cncRNA ID	CNC_N_000170
	Name	Mrln
	Gene ID	ENSMUSG00000019933
Location	Coordinate(Strand)	10:70204664-70219711(+)
Notes	It has been re-annotated as protein coding gene now
Locus Sequence
Organism	Mus musculus

Peptide information:

  

Peptide	MSGKSWVLISTTSPQSLEDEILGRLLKILFVLFVDLMSIMYVVITS
Peptide length	46

Evidence support:

  

In vivo/vitro assay	In vitro assay and in vivo assay (Mouse)
Low-throughput method	Western blotting
High-throughput method	/
Tissue/Cell	C2C12 cell
Description of experimental evidence	The peptide was detected by western blotting in C2C12 cell, which can interact with SERCA to regulate muscle performance.

Orthologues:

  

Human	ENSG00000227877
Chimpanzee	ENSPTRG00000045653
Drosophila	/
Zebrafish	/

References:

  

PMID	25640239
Description	We discovered a conserved micropeptide, which we named myoregulin (MLN), encoded by a skeletal muscle-specific RNA annotated as a putative long noncoding RNA.

Related Interactions:

  

  

   Notes: You can browse the related interactions in RNAinter by click the above link (since the interaction entries are too much to show here).