Basic information:

Translated ncRNA: lncRNA

Related IDs	cncRNA ID	CNC_N_000152
	Name	Smim6
	Gene ID	ENSMUSG00000075420
Location	Coordinate(Strand)	11:115912017-115913920(+)
Notes	It has been re-annotated as protein coding gene now
Locus Sequence
Organism	Mus musculus

Peptide information:

  

Peptide	MGQMVPPRSIQNEDFWKNPWDVGGLTVIGLFTSTFLLFVLFAVVFGYVEKAVFEEE
Peptide length	56

Evidence support:

  

In vivo/vitro assay	In vitro assay and in vivo assay (Mouse)
Low-throughput method	RNA co-immunoprecipitation;GFP Immunofluorescence
High-throughput method	/
Tissue/Cell	COS-7 cell
Description of experimental evidence	The peptide was detected by coimmunoprecipitation and GFP Immunofluorescence in COS-7 cell, which share key amino acids with their muscle-specific counterparts and function as direct inhibitors of SERCA pump activity.

Orthologues:

  

Human	/
Chimpanzee	/
Drosophila	/
Zebrafish	/

References:

  

PMID	27923914
Description	We identified two transmembrane micropeptides, endoregulin (ELN) and another-regulin (ALN), that share key amino acids with their muscle-specific counterparts and function as direct inhibitors of SERCA pump activity.