Basic information:

Translated ncRNA: lncRNA

Related IDs	cncRNA ID	CNC_N_000148
	Name	Dworf
	Gene ID	ENSMUSG00000103476
Location	Coordinate(Strand)	3:63481112-63483879(-)
Notes	It has been re-annotated as protein coding gene now
Locus Sequence
Organism	Mus musculus

Peptide information:

  

Peptide	MAEKESTSPHLMVPILLLVGWIVGCIIVIYIVFF
Peptide length	34

Evidence support:

  

In vivo/vitro assay	In vitro assay and in vivo assay (Mouse)
Low-throughput method	Western blotting
High-throughput method	/
Tissue/Cell	Heart;Soleus
Description of experimental evidence	The peptide was detected by western blotting in heart and soleus cell, which can enhances SERCA activity.

Orthologues:

  

Human	/
Chimpanzee	/
Drosophila	/
Zebrafish	/

References:

  

PMID	26816378
Description	We discovered a putative muscle-specific long noncoding RNA that encodes a peptide of 34 amino acids and that we named dwarf open reading frame (DWORF).DWORF localizes to the SR membrane, where it enhances SERCA activity by displacing the SERCA inhibitors, phospholamban, sarcolipin, and myoregulin.