Basic information:

Translated ncRNA: lncRNA

Related IDs	cncRNA ID	CNC_N_000373
	Name	Mtln
	Gene ID	ENSMUSG00000051319
Location	Coordinate(Strand)	2:127791388-127792488(-)
Notes	It has been re-annotated as protein coding gene now
Locus Sequence
Organism	Mus musculus

Peptide information:

  

Peptide	MADVSERTLQVSVLVAFASGVVLGWQANRLRRRYLDWRKRRLQDKLATTQKKLDLA
Peptide length	56

Evidence support:

  

In vivo/vitro assay	In vitro assay and in vivo assay (Mouse)
Low-throughput method	Western blotting;Liquid chromatography-tandem mass spectrometry (LC-MS/MS)
High-throughput method	/
Tissue/Cell	Quadriceps muscle cell;HEK293 cell;C2C12 cell;
Description of experimental evidence	The peptide was detected by western blotting and LC-MS/MS in mouse quadriceps muscle, which can enhance fatty acid beta-oxidation.

Orthologues:

  

Human	ENSG00000175701
Chimpanzee	ENSPTRG00000050960
Drosophila	/
Zebrafish	/

References:

  

PMID	29949755
Description	Micropeptide regulator of Beta-oxidation (MOXI) is a conserved muscle-enriched protein encoded by an RNA transcript misannotated as non-coding.