Basic information:

Translated ncRNA: lncRNA

Related IDs	cncRNA ID	CNC_N_000116
	Name	CASIMO1
	Gene ID	ENSG00000267795
Location	Coordinate(Strand)	16:4788395-4796491(+)
Notes	It has been re-annotated as protein coding gene now
Locus Sequence
Organism	Homo sapiens

Peptide information:

  

Peptide	MAVSTEELEATVQEVLGRLKSHQFFQSTWDTVAFIVFLTFMGTVLLLLLLVVAHCCCCSSPGPRRESPRKERPKGVDNLALEP
Peptide length	83

Evidence support:

  

In vivo/vitro assay	In vitro assay
Low-throughput method	Western blotting
High-throughput method	/
Tissue/Cell	MCF7 cell;KPL1 cell;MDA-MB-231 cell
Description of experimental evidence	The peptide was detected by western blotting in MCF7 cell, which can control cell proliferation and interacts with squalene epoxidase modulating lipid droplet formation. The function of peptide was validated in MCF7 cell, KPL1 cell and MDA-MB-231 cell.

Orthologues:

  

Chimpanzee	ENSPTRG00000042971
Mouse	ENSMUSG00000096215
Drosophila	/
Zebrafish	ENSDARG00000105068

References:

  

PMID	29765154
Description	We report the identification and characterization of a novel microprotein of 10 kDa, which we named Cancer-Associated Small Integral Membrane Open reading frame 1 (CASIMO1). The proliferation phenotype upon overexpression is observed only with CASIMO1 protein expression, but not with a non-translatable mutant attributing the effects to the sORF-derived protein rather than a lncRNA function.

Related Diseases:

  

Disease	MNDR ID	Link to MNDR
Breast cancer	MNDR-E-LNC-27873	Link to MNDR