Basic information:

Translated ncRNA: pri-miRNA

Related IDs	cncRNA ID	CNC_N_000808
	Name	zma-MIR171i
	Gene ID	MI0001838
Location	Coordinate(Strand)	1:278093492-278093595(+)
Locus Sequence
Organism	Zea mays

Peptide information:

  

Peptide	MIARYIEREMTSKLGRGRKRAARLVAVFLLG
Peptide length	31

Evidence support:

  

In vivo/vitro assay	In vivo assay (Zea mays)
Low-throughput method	qRT-PCR
High-throughput method	/
Tissue/Cell	/
Description of experimental evidence	The peptide was synthesized by Smartox Inc., which can enhance the accumulation of their corresponding mature miRNAs. The expression of the miRNA was detected by qRT-PCR on plant (synthetic peptide treatment).

Orthologues:

  

Human	/
Chimpanzee	/
Mouse	/
Drosophila	/
Zebrafish	/

References:

  

PMID	28041928
Description	LOM1 expression and mycorrhizal colonization decreased significantly in response to all the miPEPs except to that corresponding to miR171b, which activated both expression of LOM1 and mycorrhization. All the miPEPs data were collected from Figure 2.