Basic information:

Translated ncRNA: lncRNA

Related IDs	cncRNA ID	CNC_N_000103
	Name	blr
	Gene ID	2847682
Locus Sequence
Organism	Escherichia coli

Peptide information:

  

Peptide	MNRLIELTGWIVLVVSVILLGVASHIDNYQPPEQSASVQHK
Peptide length	41

Evidence support:

  

In vivo/vitro assay	In vitro assay and in vivo assay (E. coli)
Low-throughput method	Western blotting
High-throughput method	/
Tissue/Cell	E. coli
Description of experimental evidence	The peptide was detected by western blotting in E. coli, which can affect intrinsic susceptibility to certain inhibitors of peptidoglycan synthesis.

Orthologues:

  

Human	/
Chimpanzee	/
Mouse	/
Drosophila	/
Zebrafish	/

References:

  

PMID	10931331
Description	Intergenic' Blr gene in Escherichia Coli encodes a 41-residue membrane protein affecting intrinsic susceptibility to certain inhibitors of peptidoglycan synthesis.