Basic information:

Translated ncRNA: lncRNA

Related IDs	cncRNA ID	CNC_N_000738
	Name	SPAR
	Gene ID	ENSG00000235387
Location	Coordinate(Strand)	9:35909490-35937153(+)
Notes	It has been re-annotated as protein coding gene now
Locus Sequence
Organism	Homo sapiens

Peptide information:

  

Peptide	METAVIGVVVVLFVVTVAITCVLCCFSCDSRAQDPQGGPGRSFTVATFRQEASLFTGPVRHAQPVPSAQDFWTFM
Peptide length	75

Evidence support:

  

In vivo/vitro assay	In vitro assay
Low-throughput method	Western blotting;Immunoprecipitation
High-throughput method	/
Tissue/Cell	Hela cell
Description of experimental evidence	The peptide was detected by western blotting and immunoprecipitation in Hela cell, which can regulate mTORC1 and muscle regeneration.

Orthologues:

  

Chimpanzee	ENSPTRG00000043422
Mouse	ENSMUSG00000028475
Drosophila	/
Zebrafish	/

References:

  

PMID	28024296
Description	Here we identify and functionally characterize a novel polypeptide encoded by the lncRNA LINC00961. This polypeptide is conserved between human and mouse. we termed this polypeptide 'small regulatory polypeptide of amino acid response' (SPAR).