Go Back
Detail Information
Basic information:
Translated ncRNA: lncRNA
| Related IDs | cncRNA ID | CNC_N_000099 | |
|---|---|---|---|
| Name | BANCR | ||
| Gene ID | ENSG00000278910 | ||
| Location | Coordinate(Strand) | 9:69296682-69311111(-) | |
| Locus Sequence | |||
| Organism | Homo sapiens | ||
Peptide information:
| Peptide | MDSTVILSCVRSKNLLVGSGLGPFSGNIFLVTMKGQY | |
|---|---|---|
| Peptide length | 37 | |
Evidence support:
| In vivo/vitro assay | In vitro assay | |
|---|---|---|
| Low-throughput method | In vitro translation assay | |
| High-throughput method | / | |
| Tissue/Cell | / | |
| Description of experimental evidence | The peptide was detected by in vitro translation assay. | |
Orthologues:
| Chimpanzee | / |
|---|---|
| Mouse | / |
| Drosophila | / |
| Zebrafish | / |
References:
| PMID | 31155234 |
|---|---|
| Description | We identify hundreds of previously undetected microproteins, expressed from lncRNAs and circRNAs, for which we validate the protein products in vivo. The data were collected from supplementary tables. |
Related Diseases:
| Disease | MNDR ID | Link to MNDR |
|---|---|---|
| Oral squamous cell carcinoma | MNDR-E-LNC-04669 | Link to MNDR |
| Gastric cancer | MNDR-E-LNC-04670 | Link to MNDR |
| Bladder cancer | MNDR-E-LNC-04671 | Link to MNDR |
| Lung cancer | MNDR-E-LNC-04672 | Link to MNDR |
| Endometrial cancer | MNDR-E-LNC-04673 | Link to MNDR |
| Eosinophilic esophagitis | MNDR-E-LNC-04674 | Link to MNDR |
| Breast cancer | MNDR-E-LNC-04675 | Link to MNDR |
| Thyroid cancer | MNDR-E-LNC-04676 | Link to MNDR |
| Pancreatic cancer | MNDR-E-LNC-04677 | Link to MNDR |
| Melanoma | MNDR-E-LNC-04678 | Link to MNDR |
| Atherosclerosis | MNDR-E-LNC-04679 | Link to MNDR |
| Endometrial carcinoma | MNDR-E-LNC-04680 | Link to MNDR |
| Gastrointestinal system cancer | MNDR-E-LNC-04681 | Link to MNDR |
| Osteosarcoma | MNDR-E-LNC-04682 | Link to MNDR |
| Gastric adenocarcinoma | MNDR-E-LNC-04683 | Link to MNDR |
| Esophagus squamous cell carcinoma | MNDR-E-LNC-04684 | Link to MNDR |
| Non small cell lung cancer | MNDR-E-LNC-04685 | Link to MNDR |
| Papillary thyroid cancer | MNDR-E-LNC-04686 | Link to MNDR |
| Clear cell renal cell carcinoma | MNDR-E-LNC-04687 | Link to MNDR |
| Esophageal cancer | MNDR-E-LNC-04688 | Link to MNDR |
| Hepatocellular carcinoma | MNDR-E-LNC-04689 | Link to MNDR |
| Retinoblastoma | MNDR-E-LNC-04690 | Link to MNDR |
| Colorectal cancer | MNDR-E-LNC-04691 | Link to MNDR |
| Esophageal squamous cell cancer | MNDR-E-LNC-04692 | Link to MNDR |
Related Interactions:
Notes: You can browse the related interactions in RNAinter by click the above link (since the interaction entries are too much to show here).