Go Back
Detail Information
Basic information:
Translated ncRNA: lncRNA
| Related IDs | cncRNA ID | CNC_N_000725 | |
|---|---|---|---|
| Name | BX005461.1 | ||
| Gene ID | ENSDARG00000096447 | ||
| Location | Coordinate(Strand) | 24:1106270-1107907(+) | |
| Locus Sequence | |||
| Organism | Danio rerio | ||
Peptide information:
| Peptide | MLVNLTRMHAHSGASPLGVKVDQRCVICMFSSFHVAGKLKEMIFAKL | |
|---|---|---|
| Peptide length | 47 | |
Evidence support:
| In vivo/vitro assay | In vitro assay | |
|---|---|---|
| Low-throughput method | / | |
| High-throughput method | Liquid chromatography-tandem mass spectrometry (LC-MS/MS) | |
| Tissue/Cell | Embryo | |
| Description of experimental evidence | The peptide was detected by MS in embryo. | |
Orthologues:
| Human | / |
|---|---|
| Chimpanzee | / |
| Mouse | / |
| Drosophila | / |
References:
| PMID | 24705786 |
|---|---|
| Description | These results identify micropeptide-encoding genes in vertebrates, providing an entry point to define their function in vivo. The data were collected from supplemently tables. |