Go Back

Detail Information


Basic information:


Translated ncRNA: lncRNA

Related IDs cncRNA ID CNC_N_000724
Name NR_024022
Gene ID ENSG00000170364
Location Coordinate(Strand) 3:4303304-4320567(+)
Notes It has been re-annotated as protein coding gene now
Locus Sequence
Organism Homo sapiens

Peptide information:

  
Peptide PRPGPFSVDPRHHISKGVVIFSPFPEAQNR
Peptide length 30

Evidence support:

  
In vivo/vitro assay In vitro assay
Low-throughput method /
High-throughput method Multiple reaction monitoring (MRM)
Tissue/Cell MHCCLM3 cell;A549 cell;HBE cell;MHCC97H cell;H1299 cell;Hep3B cell
Description of experimental evidence The peptide was detected by MRM in human cell lines(A549 cell;H1299 cell;HBE cell;Hep3B cell;MHCC97H cell;MHCCLM3 cell).

Orthologues:

  
Chimpanzee ENSPTRG00000047540  
Mouse /
Drosophila /
Zebrafish /

References:

  
PMID 31340039
Description With shotgun proteomics, 308 lncRNA-encoded new proteins were detected. A total of 207 unique peptides of these new proteins were verified by multiple reaction monitoring (MRM) and/or parallel reaction monitoring (PRM), and 10 new proteins were verified by immunoblotting. The data were collected from Supplementary tables.

Related Interactions:

  

  

   Notes: You can browse the related interactions in RNAinter by click the above link (since the interaction entries are too much to show here).