Go Back

Detail Information


Basic information:


Translated ncRNA: lncRNA

Related IDs cncRNA ID CNC_N_001305
Name AL034370.1
Gene ID ENSG00000214019
Location Coordinate(Strand) X:44029332-44030921(+)
Locus Sequence
Organism Homo sapiens

Peptide information:

  
Peptide MITAAYVPLPTYHNLFPDSMTATQLLVPSR
Peptide length 30

Evidence support:

  
In vivo/vitro assay In vitro assay
Low-throughput method /
High-throughput method Liquid chromatography-tandem mass spectrometry (LC-MS/MS)
Tissue/Cell H1-hESC cell;Neural cell
Description of experimental evidence The peptide was detected by LC-MS/MS in human cell lines(H1-hESC cell;neural cell).

Orthologues:

  
Chimpanzee /
Mouse /
Drosophila /
Zebrafish /

References:

  
PMID 22955616
Description The Mass Spectrometry data from ENCODE were mapping to lincRNAs by SmProt database.

Related Interactions:

  

  

   Notes: You can browse the related interactions in RNAinter by click the above link (since the interaction entries are too much to show here).