Basic information:

Translated ncRNA: lncRNA

Related IDs	cncRNA ID	CNC_N_000094
	Name	Toddler
	Gene ID	ENSDARG00000094729
Location	Coordinate(Strand)	1:19667947-19673900(-)
Notes	It has been re-annotated as protein coding gene now
Locus Sequence
Organism	Danio rerio

Peptide information:

  

Peptide	MRFFHPLYLLLLLLTVLVLISADKHGTKHDFLNLRRKYRRHNCPKKRCLPLHSRVPFP
Peptide length	58

Evidence support:

  

In vivo/vitro assay	In vitro assay and in vivo assay (Embryo)
Low-throughput method	Liquid chromatography-tandem mass spectrometry (LC-MS/MS);Toddler-eGFP secretion assay
High-throughput method	/
Tissue/Cell	Embryo
Description of experimental evidence	The peptide was detected by Toddler-eGFP secretion assay and LC-MS/MS in embryo, which can promote cell movement via apelin receptors.

Orthologues:

  

Human	/
Chimpanzee	/
Mouse	/
Drosophila	/

References:

  

PMID	24407481
Description	We identified 28 candidate signaling proteins expressed during zebrafish embryogenesis, including Toddler, a short, conserved, and secreted peptide.