Go Back

Detail Information


Basic information:


Translated ncRNA: pri-miRNA

Related IDs cncRNA ID CNC_N_000803
Name ath-MIR164a
Gene ID MI0000197
Location Coordinate(Strand) 2:19520517-19521033(+)
Locus Sequence
Organism Arabidopsis thaliana

Peptide information:

  
Peptide MPSWHGMVLLPYVKHTHASTHTHTHNIYGCACELVFH
Peptide length 37

Evidence support:

  
In vivo/vitro assay In vivo assay (Arabidopsis thaliana)
Low-throughput method qRT-PCR
High-throughput method /
Tissue/Cell /
Description of experimental evidence The peptide was synthesized by Smartox Inc., which can enhance the accumulation of their corresponding mature miRNAs. The expression of the miRNA was detected by qRT-PCR on plant (synthetic peptide treatment).

Orthologues:

  
Human /
Chimpanzee /
Mouse /
Drosophila /
Zebrafish /

References:

  
PMID 25807486
Description The pri-miR171b of Medicago truncatula and the pri-miR165a of Arabidopsis thaliana produce peptides, which we term miPEP171b and miPEP165a, respectively, that enhance the accumulation of their corresponding mature miRNAs, resulting in downregulation of target genes involved in root development. Other miPEPs (ath-MIR160a, ath-MIR164a, ath-MIR319a and ath-MIR169d) such as were collected from extended figures.