Go Back
Detail Information
Basic information:
Translated ncRNA: lncRNA
| Related IDs | cncRNA ID | CNC_N_001114 | |
|---|---|---|---|
| Name | POLR2J4 | ||
| Gene ID | ENSG00000272655 | ||
| Location | Coordinate(Strand) | 7:44013562-44019170(-) | |
| Locus Sequence | |||
| Organism | Homo sapiens | ||
Peptide information:
| Peptide | VQTTPDYSPQEAFTNAITDLISELSLLEER | |
|---|---|---|
| Peptide length | 30 | |
Evidence support:
| In vivo/vitro assay | In vitro assay | |
|---|---|---|
| Low-throughput method | / | |
| High-throughput method | Liquid chromatography-tandem mass spectrometry (LC-MS/MS) | |
| Tissue/Cell | GM12878 cell | |
| Description of experimental evidence | The peptide was detected by LC-MS/MS in human cell lines(GM12878 cell). | |
Orthologues:
| Chimpanzee | / |
|---|---|
| Mouse | / |
| Drosophila | / |
| Zebrafish | / |
References:
| PMID | 22955616 |
|---|---|
| Description | The Mass Spectrometry data from ENCODE were mapping to lincRNAs by SmProt database. |
Related Subcelluar Localization:
| Subcelluar Localization | RLID | Link to RNALocate |
|---|---|---|
| chromatin | RLID00109950 | Link to RNALocate |
| nucleoplasm | RLID00109951 | Link to RNALocate |
| nucleus | RLID00109952 | Link to RNALocate |
| nucleus | RLID00109953 | Link to RNALocate |
| exosome | RLID00109954 | Link to RNALocate |
Related Diseases:
| Disease | MNDR ID | Link to MNDR |
|---|---|---|
| Esophageal cancer | MNDR-E-LNC-21189 | Link to MNDR |
Related Interactions:
Notes: You can browse the related interactions in RNAinter by click the above link (since the interaction entries are too much to show here).