Basic information:

Translated ncRNA: lncRNA

Related IDs	cncRNA ID	CNC_N_000647
	Name	MYO15B
	Gene ID	ENSG00000266714
Location	Coordinate(Strand)	17:75588058-75626849(+)
Notes	It has been re-annotated as protein coding gene now
Locus Sequence
Organism	Homo sapiens

Peptide information:

  

Peptide	FFPVSGESGSDVQIIAVSHRAIAHDPGIEVGAGGKVTSVH
Peptide length	40

Evidence support:

  

In vivo/vitro assay	In vitro assay
Low-throughput method	/
High-throughput method	Multiple reaction monitoring (MRM);Heavy-multiple reaction monitoring (Heavy-PRM)
Tissue/Cell	MHCCLM3 cell;A549 cell;HBE cell;MHCC97H cell;H1299 cell;Hep3B cell;Hela cell
Description of experimental evidence	The peptide was detected by MRM in human cell lines(A549 cell;H1299 cell;HBE cell;Hep3B cell;MHCC97H cell;MHCCLM3 cell) and heavy-PRM in human cell lines(A549 cell;H1299 cell;HBE cell;Hep3B cell;MHCC97H cell;MHCCLM3 cell;Hela cell).

Orthologues:

  

Chimpanzee	ENSPTRG00000049499
Mouse	ENSMUSG00000034427
Drosophila	/
Zebrafish	ENSDARG00000074852

References:

  

PMID	31340039
Description	With shotgun proteomics, 308 lncRNA-encoded new proteins were detected. A total of 207 unique peptides of these new proteins were verified by multiple reaction monitoring (MRM) and/or parallel reaction monitoring (PRM), and 10 new proteins were verified by immunoblotting. The data were collected from Supplementary tables.

Related Diseases:

  

Disease	MNDR ID	Link to MNDR
Glioblastoma multiforme	MNDR-E-LNC-18635	Link to MNDR

Related Interactions:

  

  

   Notes: You can browse the related interactions in RNAinter by click the above link (since the interaction entries are too much to show here).