Go Back
Detail Information
Basic information:
Translated ncRNA: lncRNA
| Related IDs | cncRNA ID | CNC_N_000625 | |
|---|---|---|---|
| Name | mciZ | ||
| Gene ID | 37862900 | ||
| Locus Sequence | |||
| Organism | Bacillus subtilis | ||
Peptide information:
| Peptide | VKVHRMPKGVVLVGKAWEIRAKLKEYGRTFQYVKDWISKP | |
|---|---|---|
| Peptide length | 40 | |
Evidence support:
| In vivo/vitro assay | In vitro assay and in vivo assay (Bacillus subtilis) | |
|---|---|---|
| Low-throughput method | Affinity chromatography;SDS-PAGE;Western blotting | |
| High-throughput method | / | |
| Tissue/Cell | Bacillus subtilis | |
| Description of experimental evidence | The peptide was detected by affinity chromatography, SDS-polyacrylamide gel electrophoresis and western blotting in Bacillus subtilis. | |
Orthologues:
| Human | / |
|---|---|
| Chimpanzee | / |
| Mouse | / |
| Drosophila | / |
| Zebrafish | / |
References:
| PMID | 18284588 |
|---|---|
| Description | We discovered a 40-amino-acid peptide, termed MciZ, from Bacillus subtilis that appeared to interact with FtsZ. Cells engineered to produce MciZ during growth formed aseptate filaments that lacked Z-rings. |