Go Back
Detail Information
Basic information:
Translated ncRNA: lncRNA
| Related IDs | cncRNA ID | CNC_N_000613 | |
|---|---|---|---|
| Name | MGC16025 | ||
| Gene ID | 85009 | ||
| Location | Coordinate(Strand) | 2:239193331-239195457(-) | |
| Locus Sequence | |||
| Organism | Homo sapiens | ||
Peptide information:
| Peptide | MVFDTEIAQVTSDTAVGARMRECDCGSHLCSWCVGPGLGQLGPHPHPPGSQDPH | |
|---|---|---|
| Peptide length | 54 | |
Evidence support:
| In vivo/vitro assay | In vitro assay | |
|---|---|---|
| Low-throughput method | Western blotting;Liquid chromatography-tandem mass spectrometry (LC-MS/MS) | |
| High-throughput method | / | |
| Tissue/Cell | M113 cell;Melanocyte;Melanoma cell;Peripheral blood mononuclear cell | |
| Description of experimental evidence | The peptide was detected by western blotting and LC-MS/MS in M113 cell,melanocyte and melanoma cell which showed a a poor immunogen as compared to MELOE-1. | |
Orthologues:
| Chimpanzee | / |
|---|---|
| Mouse | / |
| Drosophila | / |
| Zebrafish | / |
References:
| PMID | 27486971 |
|---|---|
| Description | We document the expression of an additional ORF, MELOE-3, located in the 5′ region of meloe. Data from in vitro translation experiments and transfection of melanoma cells with bicistronic vectors documented that MELOE-3 is exclusively translated by the classical cap-dependent pathway. |