Basic information:

Translated ncRNA: lncRNA

Related IDs	cncRNA ID	CNC_N_000604
	Name	NBDY
	Gene ID	ENSG00000204272
Location	Coordinate(Strand)	X:56729241-56819179(+)
Notes	It has been re-annotated as protein coding gene now
Locus Sequence
Organism	Homo sapiens

Peptide information:

  

Peptide	MGDQPCASGRSTLPPGNAREAKPPKKRCLLAPRWDYPEGTPNGGSTTLPSAPPPASAGLKSHPPPPEK
Peptide length	68

Evidence support:

  

In vivo/vitro assay	In vitro assay
Low-throughput method	Immunofluorescence;Liquid chromatography-tandem mass spectrometry (LC-MS/MS)
High-throughput method	/
Tissue/Cell	K562 cell;HEK293T cell;MDA-MB-231 cell
Description of experimental evidence	The peptide was detected by immunofluorescence and LC-MS/MS in K562 cell and HEK293T cell, which can interact with the mRNA decapping complex, and the function of peptide was validated in HEK293T cell.

Orthologues:

  

Chimpanzee	ENSPTRG00000052659
Mouse	/
Drosophila	/
Zebrafish	/

References:

  

PMID	27918561
Description	Here, we report the discovery and characterization of a 7-kDa human microprotein we named non-annotated P-body dissociating polypeptide (NoBody). NoBody interacts with mRNA decapping proteins, which remove the 5' cap from mRNAs to promote 5'-to-3' decay.