Basic information:

Translated ncRNA: lncRNA

Related IDs	cncRNA ID	CNC_N_001814
	Name	Spaar
	Gene ID	ENSMUSG00000028475
Location	Coordinate(Strand)	4:43730034-43759462(+)
Notes	It has been re-annotated as protein coding gene now
Locus Sequence
Organism	Mus musculus

Peptide information:

  

Peptide	METAVIGMVAVLFVITMAITCILCYFSYDSHTQDPERSSRRSFTVATFHQEASLFTGPALQSRPLPRPQNFWTVV
Peptide length	75

Evidence support:

  

In vivo/vitro assay	In vitro assay and in vivo assay (Mouse)
Low-throughput method	Western blotting;Immunoprecipitation
High-throughput method	/
Tissue/Cell	Skeletal muscle
Description of experimental evidence	The peptide was detected by western blotting and immunoprecipitation in mouse skeletal muscle, which can regulate mTORC1 and muscle regeneration.

Orthologues:

  

Human	ENSG00000235387
Chimpanzee	ENSPTRG00000043422
Drosophila	/
Zebrafish	/

References:

  

PMID	28024296
Description	Here we identify and functionally characterize a novel polypeptide encoded by the lncRNA LINC00961. This polypeptide is conserved between human and mouse. we termed this polypeptide 'small regulatory polypeptide of amino acid response' (SPAR).

Related Interactions:

  

  

   Notes: You can browse the related interactions in RNAinter by click the above link (since the interaction entries are too much to show here).